PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 26145.4 Da    PI: 9.6455
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513723.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.55.4e-312574150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++g+lyey+
  XP_004513723.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSTRGRLYEYA 74
                    79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.7961777IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-411776IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-331893IPR002100Transcription factor, MADS-box
CDDcd002652.47E-431891No hitNo description
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-331939IPR002100Transcription factor, MADS-box
PfamPF003191.9E-262673IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-335475IPR002100Transcription factor, MADS-box
PfamPF014863.3E-19100182IPR002487Transcription factor, K-box
PROSITE profilePS5129712.737103197IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MELPNHEDGE GSSQKKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVVFSTRGRL YEYANNSVRA TIERYKKACS ATTNAESVSE ANTQFYQQES SKLRRQIRDI  120
QNLNRHILGE ALGSLSLKEL KNLEGRLEKG LSRVRSRKEI DLQNQNNYLR AKIAECERAQ  180
QQQQNMMPET YSESLPSQSY DRNFFPVNLL GSDQQYSRQD QTALQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-201785169Myocyte-specific enhancer factor 2B
1tqe_R1e-201785169Myocyte-specific enhancer factor 2B
1tqe_Q1e-201785169Myocyte-specific enhancer factor 2B
1tqe_P1e-201785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2975660.0JX297566.1 Medicago monspeliaca voucher PI 641560 shatterproof mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513723.11e-167PREDICTED: agamous-like MADS-box protein AGL1 isoform X2
SwissprotP293811e-108AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLQ56NI21e-149Q56NI2_PEA; MADS box protein M8
STRINGGLYMA14G03100.11e-131(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-109MIKC_MADS family protein